PPIRE18993
Target Protein Information
| Protein_Name | Diphtheria toxin repressor |
|---|---|
| Protein_Sequence | MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVGNSDAAAPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELLDDLAHTIRIEEL |
| Organism_Source | Corynebacterium diphtheriae (strain PW8) |
| Functional_Classification | Metal dependent transcriptional repressors Fur family |
| Cellular_Localization | Cytoplasm |
| Gene_Names | dtxR |
| UniProt_ID | H2I233 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | DtxR R125-G139 peptide |
|---|---|
| Peptide_Sequence | RSPFGNPIPGLDELG |
| Peptide_Length | 15 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CO)NC(=O)[C@@H](N)CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1568.75 |
|---|---|
| Aliphatic_Index | 78.00000 |
| Aromaticity | 0.06667 |
| Average_Rotatable_Bonds | 3.06667 |
| Charge_at_pH_7 | -0.99980 |
| Isoelectric_Point | 4.18441 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 644.17000 |
| X_logP_energy | -6.55023 |
Interaction Information
| Affinity | KD=100 mM |
|---|---|
| Affinity_Assay | NMR chemical shift perturbation |
| PDB_ID | 1BYM |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Solution structure and peptide binding studies of the C-terminal Src homology 3-like domain of the diphtheria toxin repressor protein |
| Release_Year | 1999 |
| PMID | 10339551 |
| DOI | 10.1073/pnas.96.11.6119 |