PPIRE19031
Target Protein Information
| Protein_Name | Lysozyme C |
|---|---|
| Protein_Sequence | MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL |
| Organism_Source | Gallus gallus |
| Functional_Classification | glycosidases |
| Cellular_Localization | Extracellular |
| Gene_Names | LYZ |
| UniProt_ID | P00698 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Cys6-7 |
|---|---|
| Peptide_Sequence | VNIACNPTDIQCLIRLPAEXXK |
| Peptide_Length | 22 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)NCC(=O)NCC(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)CC)[C@@H](C)CC)[C@@H](C)O |
| Chemical_Modification | X20=biotinylated lysine; X21=norleucine |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2325.73 |
|---|---|
| Aliphatic_Index | 110.90909 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.40909 |
| Charge_at_pH_7 | -0.12404 |
| Isoelectric_Point | 6.22098 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 33 |
| Number_of_Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 968.86000 |
| X_logP_energy | -10.23093 |
Interaction Information
| Affinity | KD=64.5 nM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Role of Structure in Antibody Cross-reactivity Between Peptides and Folded Proteins |
| Release_Year | 1998 |
| PMID | 9680484 |
| DOI | 10.1006/jmbi.1998.1907 |