PPIRE19175
Target Protein Information
| Protein_Name | Protein S100-A4 |
|---|---|
| Protein_Sequence | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK |
| Organism_Source | Homo sapiens |
| Functional_Classification | calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100A4 |
| UniProt_ID | P26447 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | FITC-MIIA1908-1923 |
|---|---|
| Peptide_Sequence | DAMNREVSSLKNKLRR |
| Peptide_Length | 16 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | FITC-Ahx |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1917.22 |
|---|---|
| Aliphatic_Index | 73.12500 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.37500 |
| Charge_at_pH_7 | 2.99961 |
| Isoelectric_Point | 11.55035 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 29 |
| Number_of_Hydrogen_Bond_Donors | 34 |
| Topological_Polar_Surface_Area | 938.80000 |
| X_logP_energy | -11.68579 |
Interaction Information
| Affinity | KD=0.89 uM |
|---|---|
| Affinity_Assay | Fluorescence Polarization |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Structure of Ca2+-Bound S100A4 and Its Interaction with Peptides Derived from Nonmuscle Myosin-IIA |
| Release_Year | 2008 |
| PMID | 18410126 |
| DOI | 10.1021/bi702537s |