PPIRE19178
Target Protein Information
| Protein_Name | Centrin-2 |
|---|---|
| Protein_Sequence | MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| Organism_Source | Homo sapiens |
| Functional_Classification | EF hand calcium binding proteins |
| Cellular_Localization | Nucleus |
| Gene_Names | CETN2 |
| UniProt_ID | P41208 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | P1-XPC |
|---|---|
| Peptide_Sequence | NWKLLAKGLLIRERLKR |
| Peptide_Length | 17 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@@H](N)CC(N)=O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2107.62 |
|---|---|
| Aliphatic_Index | 143.52941 |
| Aromaticity | 0.05882 |
| Average_Rotatable_Bonds | 4.47059 |
| Charge_at_pH_7 | 4.99886 |
| Isoelectric_Point | 12.26273 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 26 |
| Number_of_Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 888.86000 |
| X_logP_energy | -4.27599 |
Interaction Information
| Affinity | KD=100 uM |
|---|---|
| Affinity_Assay | flow dialysis |
| PDB_ID | 2A4J |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Slow Backbone Dynamics of the C-Terminal Fragment of Human Centrin 2 in Complex with a Target Peptide Probed by Cross-Correlated Relaxation in Multiple-Quantum NMR Spectroscopy |
| Release_Year | 2006 |
| PMID | 17154538 |
| DOI | 10.1021/bi061469v |