PPIRE19232
Target Protein Information
| Protein_Name | Protein E6 |
|---|---|
| Protein_Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Organism_Source | Human papillomavirus type 16 |
| Functional_Classification | Viral regulatory proteins host cell cycle modulators |
| Cellular_Localization | Nucleus |
| Gene_Names | E6 |
| UniProt_ID | P03126 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | E6ap18 |
|---|---|
| Peptide_Sequence | IPESSELTLQELLGEERR |
| Peptide_Length | 18 |
| Peptide_SMILES | CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)[C@@H](C)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2099.33 |
|---|---|
| Aliphatic_Index | 108.33333 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 4.05556 |
| Charge_at_pH_7 | -2.99315 |
| Isoelectric_Point | 4.02152 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 30 |
| Number_of_Hydrogen_Bond_Donors | 33 |
| Topological_Polar_Surface_Area | 963.31000 |
| X_logP_energy | -9.51056 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and Characterization of Helical Peptides that Inhibit the E6 Protein of Papillomavirus |
| Release_Year | 2004 |
| PMID | 15182185 |
| DOI | 10.1021/bi049552a |