PPIRE19234
Target Protein Information
| Protein_Name | Protein E6 |
|---|---|
| Protein_Sequence | MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFRDLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCINCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL |
| Organism_Source | Human papillomavirus type 16 |
| Functional_Classification | Viral regulatory proteins host cell cycle modulators |
| Cellular_Localization | Nucleus |
| Gene_Names | E6 |
| UniProt_ID | P03126 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | E6apc2 |
|---|---|
| Peptide_Sequence | KKFACPECPKRFMRSDHLSKHILHELLGEKK |
| Peptide_Length | 31 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCSC)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3707.43 |
|---|---|
| Aliphatic_Index | 66.12903 |
| Aromaticity | 0.06452 |
| Average_Rotatable_Bonds | 4.16129 |
| Charge_at_pH_7 | 4.15076 |
| Isoelectric_Point | 10.13448 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 52 |
| Number_of_Hydrogen_Bond_Donors | 53 |
| Topological_Polar_Surface_Area | 1474.36000 |
| X_logP_energy | -10.81376 |
Interaction Information
| Affinity | IC50=19.3 uM |
|---|---|
| Affinity_Assay | in vitro association assay |
| PDB_ID | 1RIM |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Design and Characterization of Helical Peptides that Inhibit the E6 Protein of Papillomavirus |
| Release_Year | 2004 |
| PMID | 15182185 |
| DOI | 10.1021/bi049552a |