PPIRE19269
Target Protein Information
| Protein_Name | Transcriptional coactivator YAP1 |
|---|---|
| Protein_Sequence | MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL |
| Organism_Source | Homo sapiens |
| Functional_Classification | Transcriptional co activators |
| Cellular_Localization | Nucleus |
| Gene_Names | YAP1 |
| UniProt_ID | P46937 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | Ac-PPPPYT-NH2 |
|---|---|
| Peptide_Sequence | PPPPYT |
| Peptide_Length | 6 |
| Peptide_SMILES | C[C@@H](O)[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1C(=O)[C@@H]1CCCN1)C(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 670.76 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.16667 |
| Average_Rotatable_Bonds | 1.83333 |
| Charge_at_pH_7 | -0.00287 |
| Isoelectric_Point | 6.09320 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 6 |
| Topological_Polar_Surface_Area | 208.92000 |
| X_logP_energy | -0.90530 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Solution Structures of the YAP65 WW Domain and the Variant L30K in Complex with the Peptides GTPPPPYTVG N-(n-octyl)-GPPPY and PLPPY and the Application of Peptide Libraries Reveal a Minimal Binding Epitope |
| Release_Year | 2001 |
| PMID | |
| DOI | 10.1006/jmbi.2001.5199 |