PPIRE19356
Target Protein Information
| Protein_Name | Somatostatin receptor type 5 |
|---|---|
| Protein_Sequence | MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTLVIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDGVNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | SSTR5 |
| UniProt_ID | P35346 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | [D-Trp8-L-Dfp11]-SRIF |
|---|---|
| Peptide_Sequence | AGCKNFFwKXTSC |
| Peptide_Length | 13 |
| Peptide_SMILES | C[C@H](N)C(=O)NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O |
| Chemical_Modification | X11=L-3-(3--5--difluorophenyl)alanine; w8=D-tryptophan |
| Cyclization_Method | Side chain-side chain cyclization; C3<-->C14; disulfide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1448.68 |
|---|---|
| Aliphatic_Index | 7.69231 |
| Aromaticity | 0.23077 |
| Average_Rotatable_Bonds | 3.46154 |
| Charge_at_pH_7 | 1.87344 |
| Isoelectric_Point | 8.82168 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 22 |
| Topological_Polar_Surface_Area | 563.90000 |
| X_logP_energy | -5.92590 |
Interaction Information
| Affinity | Ki=0.76 nM |
|---|---|
| Affinity_Assay | Radioligand binding assay |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Peptide aromatic interactions modulated by fluorinated residues: Synthesis structure and biological activity of Somatostatin analogs containing 3-(3--5--difluorophenyl)-alanine |
| Release_Year | 2016 |
| PMID | 27271737 |
| DOI | 10.1038/srep27285 |