PPIRE19367
Target Protein Information
| Protein_Name | Gonadotropin-releasing hormone receptor |
|---|---|
| Protein_Sequence | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL |
| Organism_Source | Homo sapiens |
| Functional_Classification | G protein-coupled receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | GNRHR |
| UniProt_ID | P30968 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | gonadorelin |
|---|---|
| Peptide_Sequence | PHWSYGLRPG |
| Peptide_Length | 10 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CO)NC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H]1CCCN1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N1CCC[C@H]1C(=O)NCC(=O)O |
| Chemical_Modification | |
| Cyclization_Method | |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1169.31 |
|---|---|
| Aliphatic_Index | 39.00000 |
| Aromaticity | 0.20000 |
| Average_Rotatable_Bonds | 3.10000 |
| Charge_at_pH_7 | 1.08804 |
| Isoelectric_Point | 9.35118 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 17 |
| Topological_Polar_Surface_Area | 449.27000 |
| X_logP_energy | -3.10503 |
Interaction Information
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Optimized functional and structural design of dual-target LMRAP a bifunctional fusion protein with a 25-amino-acid antitumor peptide and GnRH Fc fragment |
| Release_Year | 2020 |
| PMID | 32082972 |
| DOI | 10.1016/j.apsb.2019.10.010 |