PPIRE19434
Target Protein Information
| Protein_Name | Immunoglobulin heavy variable 1-69/Immunoglobulin kappa variable 1-5 |
|---|---|
| Protein_Sequence | MDWTWRFLFVVAAATGVQSQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGGIIPIFGTANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVYYCAR/MDMRVPAQLLGLLLLWLPGAKCDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYKASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNSYS |
| Organism_Source | Homo sapiens/Homo sapiens |
| Functional_Classification | immunoglobulins |
| Cellular_Localization | Extracellular |
| Gene_Names | IGHV1-69/IGKV1-5 |
| UniProt_ID | P01742/P01602 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | minimal FLAG peptide |
|---|---|
| Peptide_Sequence | DYKD |
| Peptide_Length | 4 |
| Peptide_SMILES | NCCCC[C@H](NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CC(=O)O)C(=O)N[C@@H](CC(=O)O)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | fusion to carrier protein (N-terminus) |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 539.54 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.25000 |
| Average_Rotatable_Bonds | 4.25000 |
| Charge_at_pH_7 | -1.00227 |
| Isoelectric_Point | 4.10925 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 9 |
| Number_of_Hydrogen_Bond_Donors | 9 |
| Topological_Polar_Surface_Area | 271.47000 |
| X_logP_energy | -2.12060 |
Interaction Information
| Affinity | EC50=4.8 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | De novo design of antibody complementarity determining regions binding a FLAG tetra-peptide |
| Release_Year | 2017 |
| PMID | 28860479 |
| DOI | 10.1038/s41598-017-10737-9 |