PPIRE19472
Target Protein Information
| Protein_Name | Serine protease 1 |
|---|---|
| Protein_Sequence | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN |
| Organism_Source | Bos taurus |
| Functional_Classification | serine proteases |
| Cellular_Localization | Extracellular |
| Gene_Names | PRSS1 |
| UniProt_ID | P00760 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | cyanopeptolin VW-1 |
|---|---|
| Peptide_Sequence | XTKXFXM |
| Peptide_Length | 7 |
| Peptide_SMILES | CSCC[C@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)CN)[C@@H](C)O)C(=O)O |
| Chemical_Modification | X1=homo-tyrosine; X4=3-amino-6-hydroxy-2-piperidone; X6=N-methyl-tyrosine |
| Cyclization_Method | Main chain-main chain cyclization; X1<-->M7; amide bond |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 696.82 |
|---|---|
| Aliphatic_Index | 0.00000 |
| Aromaticity | 0.14286 |
| Average_Rotatable_Bonds | 3.28571 |
| Charge_at_pH_7 | 0.99769 |
| Isoelectric_Point | 9.70000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 284.17000 |
| X_logP_energy | -3.29310 |
Interaction Information
| Affinity | IC50=750 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | Co-occurrence of non-toxic (cyanopeptolin) and toxic (microcystin) peptides in a bloom of Microcystis sp. from a Chilean lake |
| Release_Year | 2000 |
| PMID | 10930070 |
| DOI | 10.1016/S0723-2020(00)80004-1 |