PPIRE19502
Target Protein Information
| Protein_Name | Protein S100-B |
|---|---|
| Protein_Sequence | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| Organism_Source | Rattus norvegicus |
| Functional_Classification | EF hand calcium binding proteins |
| Cellular_Localization | Cytoplasm |
| Gene_Names | S100b |
| UniProt_ID | P04631 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | p53-derived peptide |
|---|---|
| Peptide_Sequence | SHLKSKKGQSTSRHKKLMFKTE |
| Peptide_Length | 22 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](N)CO)[C@@H](C)O)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Linear |
| N-terminal_Modification | Acetyl |
| C-terminal_Modification | Amide |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 2587.04 |
|---|---|
| Aliphatic_Index | 35.45455 |
| Aromaticity | 0.04545 |
| Average_Rotatable_Bonds | 4.36364 |
| Charge_at_pH_7 | 6.17980 |
| Isoelectric_Point | 11.45768 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 41 |
| Number_of_Hydrogen_Bond_Donors | 42 |
| Topological_Polar_Surface_Area | 1151.57000 |
| X_logP_energy | -13.87153 |
Interaction Information
| Affinity | KD=94.7 uM |
|---|---|
| Affinity_Assay | proton relaxation rate |
| PDB_ID | None |
| Type | Inhibitor |
| Structure | |
Reference Information
| Document_Type | Research Articles |
|---|---|
| Title | The Ca2+-Dependent Interaction of S100B with a Peptide Derived from p53 |
| Release_Year | 1998 |
| PMID | 9485322 |
| DOI | 10.1021/bi972701n |