PPIPT00768
Target Protein Information
| Protein_Name | C-X-C motif chemokine 9 |
|---|---|
| Protein_Sequence | MKKSGVLFLLGIILLVLIGVQGTPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Organism_Source | Homo sapiens |
| Functional_Classification | Chemokine (CXC family) |
| Cellular_Localization | Extracellular |
| Gene_Names | CXCL9 |
| UniProt_ID | Q07325 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | CBP6 |
|---|---|
| Peptide_Sequence | VTTFFDYDYGAPC |
| Peptide_Length | 13 |
| Peptide_SMILES | CC(C)[C@H](N)C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | None |
| Linear/Cyclic | Cyclic |
| N-terminal_Modification | Free |
| C-terminal_Modification | Free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1498.63 |
|---|---|
| Aliphatic_Index | 30.00000 |
| Aromaticity | 0.30769 |
| Average_Rotatable_Bonds | 3.07692 |
| Charge_at_pH_7 | -2.06480 |
| Isoelectric_point | 3.49187 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 21 |
| Number_of_Hydrogen_Bond_Donors | 20 |
| Topological_Polar_Surface_Area | 559.25000 |
| X_logP_energy | -3.94780 |
Interaction Information
| Affinity | KD=2.82 uM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Allosteric modulator |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Pharmaceutical peptides for the treatment of inflammatory diseases |
| Release_Year | 2010 |
| Patent_ID | US20100227824A1 |