PPIPT02378
Target Protein Information
| Protein_Name | Interleukin-6 |
|---|---|
| Protein_Sequence | MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Organism_Source | Homo sapiens |
| Functional_Classification | Cytokine (Interleukin family) |
| Cellular_Localization | Extracellular |
| Gene_Names | IL6 |
| UniProt_ID | P05231 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | UBITh1-EK-IL-642-72 |
|---|---|
| Peptide_Sequence | ETONKSNMCESSKEALAENNLNLPKMAEKDG |
| Peptide_Length | 31 |
| Peptide_SMILES | CSCC[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](N)CCC(=O)O)[C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | None |
| C-terminal_Modification | None |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3353.70 |
|---|---|
| Aliphatic_Index | 47.41935 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.87097 |
| Charge_at_pH_7 | -2.05585 |
| Isoelectric_point | 4.41430 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 54 |
| Number_of_Hydrogen_Bond_Donors | 51 |
| Topological_Polar_Surface_Area | 1551.78000 |
| X_logP_energy | -21.60530 |
Interaction Information
| Affinity | IC50=0.69 uM |
|---|---|
| Affinity_Assay | Enzyme Inhibition Kinetics |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Peptide immunogens targeting interleukin 6 (il-6) and formulations thereof for immunotherapy of diseases impacted by il-6 dysregulation |
| Release_Year | 2022 |
| Patent_ID | US20220105163A1 |