PPIPT02418
Target Protein Information
| Protein_Name | Alpha-synuclein |
|---|---|
| Protein_Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Organism_Source | Homo sapiens |
| Functional_Classification | Synaptic regulatory protein (alpha-synuclein family) |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SNCA |
| UniProt_ID | P37840 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VLYVGSKTK |
|---|---|
| Peptide_Sequence | VLYVGSKTK |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)C(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CCCCN)C(=O)O)[C@@H](C)O)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 994.20 |
|---|---|
| Aliphatic_Index | 107.77778 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 3.66667 |
| Charge_at_pH_7 | 1.99654 |
| Isoelectric_point | 10.24761 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 15 |
| Topological_Polar_Surface_Area | 408.85000 |
| X_logP_energy | -3.15440 |
Interaction Information
| Affinity | IC50=161 nM |
|---|---|
| Affinity_Assay | competitive HLA binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Use of peptides as biomarkers in the diagnosis, confirmation and treatment of a neurological disorder and tcr and/or hla immunoprofiling in neurodegenerative disease |
| Release_Year | 2020 |
| Patent_ID | US20200095296A1 |