PPIPT02501
Target Protein Information
| Protein_Name | Insulin-like growth factor-binding protein-like 1 |
|---|---|
| Protein_Sequence | MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCLGAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHPGHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM |
| Organism_Source | Homo sapiens |
| Functional_Classification | IGF-binding regulatory protein |
| Cellular_Localization | Extracellular |
| Gene_Names | IGFBPL1 |
| UniProt_ID | Q8WX77 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | LLLPLLPPLSPS |
|---|---|
| Peptide_Sequence | LLLPLLPPLSPS |
| Peptide_Length | 12 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@@H](N)CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 1259.59 |
|---|---|
| Aliphatic_Index | 195.00000 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 2.75000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 15 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 388.72000 |
| X_logP_energy | 0.01710 |
Interaction Information
| Affinity | KD=1 uM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Agonist |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Novel peptides, combination of peptides as targets and for use in immunotherapy against gallbladder cancer and cholangiocarcinoma and other cancers |
| Release_Year | 2021 |
| Patent_ID | US20210380662A1 |