PPIPT02562
Target Protein Information
| Protein_Name | Serine/threonine-protein kinase Sgk1 |
|---|---|
| Protein_Sequence | MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL |
| Organism_Source | Homo sapiens |
| Functional_Classification | Serine/threonine protein kinase |
| Cellular_Localization | Cytoplasm |
| Gene_Names | SGK1 |
| UniProt_ID | O00141 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | SGK1-AAYPEIVAV |
|---|---|
| Peptide_Sequence | AAYPEIVAV |
| Peptide_Length | 9 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](C)NC(=O)[C@H](C)N)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)O)C(C)C)C(C)C |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 932.08 |
|---|---|
| Aliphatic_Index | 141.11111 |
| Aromaticity | 0.11111 |
| Average_Rotatable_Bonds | 2.77778 |
| Charge_at_pH_7 | -1.00109 |
| Isoelectric_point | 3.84998 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 12 |
| Number_of_Hydrogen_Bond_Donors | 11 |
| Topological_Polar_Surface_Area | 344.86000 |
| X_logP_energy | -0.98620 |
Interaction Information
| Affinity | KD=60 nM |
|---|---|
| Affinity_Assay | Surface Plasmon Resonance |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Novel peptides, combination of peptides as targets and for use in immunotherapy against gallbladder cancer and cholangiocarcinoma and other cancers |
| Release_Year | 2020 |
| Patent_ID | US20200010529A1 |