PPIPT02691
Target Protein Information
| Protein_Name | HLA class I histocompatibility antigen, A alpha chain |
|---|---|
| Protein_Sequence | MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV |
| Organism_Source | Homo sapiens |
| Functional_Classification | MHC class I antigen presentation receptor |
| Cellular_Localization | Plasma membrane |
| Gene_Names | HLA-A |
| UniProt_ID | P04439 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | VLQ |
|---|---|
| Peptide_Sequence | VLQGVLPAL |
| Peptide_Length | 9 |
| Peptide_SMILES | CC(C)C[C@H](NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1C(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)C(C)C)C(C)C)C(=O)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 909.14 |
|---|---|
| Aliphatic_Index | 205.55556 |
| Aromaticity | 0.00000 |
| Average_Rotatable_Bonds | 3.00000 |
| Charge_at_pH_7 | -0.00202 |
| Isoelectric_point | 6.10000 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 11 |
| Number_of_Hydrogen_Bond_Donors | 10 |
| Topological_Polar_Surface_Area | 330.42000 |
| X_logP_energy | -0.85000 |
Interaction Information
| Affinity | IC50=914.1 nM |
|---|---|
| Affinity_Assay | ELISA |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Antibodies as T cell receptor mimics, methods of production and uses thereof |
| Release_Year | 2009 |
| Patent_ID | US20090226474A1 |