PPIPT02739
Target Protein Information
| Protein_Name | Protein E7 |
|---|---|
| Protein_Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| Organism_Source | Virus |
| Functional_Classification | Viral oncoprotein |
| Cellular_Localization | Cytoplasm |
| Gene_Names | E7 |
| UniProt_ID | P03129 |
| Protein-Protein Interaction Networks | |
Peptide Basic Information
| Peptide_Name | E2_286-315 |
|---|---|
| Peptide_Sequence | TPIWHLKGDANTLKCLRYRFKKHCTLYTA |
| Peptide_Length | 29 |
| Peptide_SMILES | CC[C@H](C)[C@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)[C@@H](C)O)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)O)[C@@H](C)O)[C@@H](C)O)[C@@H](C)O |
| Chemical_Modification | None |
| Cyclization_Method | none |
| Linear/Cyclic | Linear |
| N-terminal_Modification | free |
| C-terminal_Modification | free |
| Amino_Acid_Distribution | |
|
|
|
Peptide Physicochemical
| Molecular_Weight | 3479.12 |
|---|---|
| Aliphatic_Index | 74.13793 |
| Aromaticity | 0.13793 |
| Average_Rotatable_Bonds | 3.86207 |
| Charge_at_pH_7 | 5.05341 |
| Isoelectric_point | 10.24843 |
|---|---|
| Number_of_Hydrogen_Bond_Acceptors | 48 |
| Number_of_Hydrogen_Bond_Donors | 52 |
| Topological_Polar_Surface_Area | 1372.13000 |
| X_logP_energy | -10.04906 |
Interaction Information
| Affinity | IC50=2.0 uM |
|---|---|
| Affinity_Assay | MHC class II binding assay |
| PDB_ID | None |
| Type | Affinity ligand |
| Structure | |
Reference Information
| Document_Type | Patent |
|---|---|
| Title | Long peptides of 22-45 amino acid residues that induce and/or enhance antigen specific immune responses |
| Release_Year | 2007 |
| Patent_ID | US20070292449A1 |