PPIST00248
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | SPLLPKLPPKTYKRE |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1GBR |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy. |
|---|---|
| Release_Year | 1994 |
| PMID | 7947763 |
| DOI | 10.1021/bi00250a004 |