PPIST00433
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | PATLKICSWNVDG |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1CQH |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The solution structure of human thioredoxin complexed with its target from Ref-1 reveals peptide chain reversal. |
|---|---|
| Release_Year | 1996 |
| PMID | 8736558 |
| DOI | 10.1016/S0969-2126(96)00065-2 |