PPIST00467
Protein Information
| Protein_Chain | A[auth C] |
|---|---|
| Protein_Sequence | GSHMGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS |
Peptide Information
| Peptide_Chain | B[auth N] |
|---|---|
| Peptide_Sequence | XXXXPLPPLPX |
| Peptide_Length | 11 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 1NLO |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Molecular basis for the binding of SH3 ligands with non-peptide elements identified by combinatorial synthesis. |
|---|---|
| Release_Year | 1996 |
| PMID | 8807900 |
| DOI | 10.1016/S1074-5521(96)90134-9 |