PPIST00504
Protein Information
| Protein_Chain | B[auth H] |
|---|---|
| Protein_Sequence | EEYKCYCTDTYSDCPGFCKTCKAEFGKYICLDLISPNDCVK |
Peptide Information
| Peptide_Chain | A[auth L] |
|---|---|
| Peptide_Sequence | TACSECVCPLR |
| Peptide_Length | 11 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 2BI6 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of bromelain inhibitor IV from pineapple stem: structural similarity with Bowman-Birk trypsin/chymotrypsin inhibitor from soybean. |
|---|---|
| Release_Year | 1996 |
| PMID | 8611527 |
| DOI | 10.1021/bi952754+ |