PPIST00529
Protein Information
| Protein_Chain | A[auth F] |
|---|---|
| Protein_Sequence | SIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLSSRLVVPSHK |
Peptide Information
| Peptide_Chain | B[auth P] |
|---|---|
| Peptide_Sequence | EPQYEEIPIYL |
| Peptide_Length | 11 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1AOU |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The SH2 domain from the tyrosine kinase Fyn in complex with a phosphotyrosyl peptide reveals insights into domain stability and binding specificity. |
|---|---|
| Release_Year | 1997 |
| PMID | 9351806 |
| DOI | 10.1016/S0969-2126(97)00283-9 |