PPIST00629
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPEFIVTD |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XVPPPVPPRRRX |
| Peptide_Length | 12 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 3GBQ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the Grb2 N-terminal SH3 domain complexed with a ten-residue peptide derived from SOS: direct refinement against NOEs, J-couplings and 1H and 13C chemical shifts. |
|---|---|
| Release_Year | 1997 |
| PMID | 9135122 |
| DOI | 10.1006/jmbi.1996.0886 |