PPIST00800
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSHMIEPNVISVRLFKRKVGGLGFLVKERVSKPPVIISDLIRGGAAEQSGLIQAGDIILAVNDRPLVDLSYDSALEVLRGIASETHVVLILRGPEGFTTHLETTFTGDGTPKTIRVTQPLGPPTKAV |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | VVKVDSV |
| Peptide_Length | 7 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1B8Q |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the extended neuronal nitric oxide synthase PDZ domain complexed with an associated peptide. |
|---|---|
| Release_Year | 1999 |
| PMID | 10331866 |
| DOI | 10.1038/8216 |