PPIST00872
Protein Information
| Protein_Chain | A[auth E] |
|---|---|
| Protein_Sequence | GSHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT |
Peptide Information
| Peptide_Chain | B[auth I] |
|---|---|
| Peptide_Sequence | DDPSYVNVQNLDK |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1QG1 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the SH2 domain of Grb2 complexed with the Shc-derived phosphotyrosine-containing peptide. |
|---|---|
| Release_Year | 1999 |
| PMID | 10356320 |
| DOI | 10.1006/jmbi.1999.2792 |