PPIST00998
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | ANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDHFKSTDAE |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | RIQRNKAAALLRLAAR |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1DPU |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural basis for the recognition of DNA repair proteins UNG2, XPA, and RAD52 by replication factor RPA. |
|---|---|
| Release_Year | 2000 |
| PMID | 11081631 |
| DOI | 10.1016/S0092-8674(00)00136-7 |