PPIST01056
Protein Information
| Protein_Chain | B |
|---|---|
| Protein_Sequence | QVQLLESGPGLVRPSETLSLTCTVSGFSLTSFSVSWVRHPSGKGPEWMGRMWYDGYTAYNSALKSRLSISRDTSKNQVFLKMNSLQTDDTGTYYCTRDLYGGYPLGFWYFDFWGPGTMVTVSSGGGGSGGGGSGGGGSDIKLTQSPSLLSASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCYQYNNGYTFGAGTKLELKAAEQKLISEEDLN |
Peptide Information
| Peptide_Chain | A |
|---|---|
| Peptide_Sequence | WNPGDYGGIL |
| Peptide_Length | 10 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1F3R |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The third-dimensional structure of the complex between an Fv antibody fragment and an analogue of the main immunogenic region of the acetylcholine receptor: a combined two-dimensional NMR, homology, and molecular modeling approach. |
|---|---|
| Release_Year | 2000 |
| PMID | None |
| DOI | 10.1002/(SICI)1097-0282(200002)53:2<113::AID-BIP1>3.3.CO;2-A |