PPIST01087
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | EEEYMPMEDLYLDIL |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1FU5 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR structure of the N-SH2 of the p85 subunit of phosphoinositide 3-kinase complexed to a doubly phosphorylated peptide reveals a second phosphotyrosine binding site. |
|---|---|
| Release_Year | 2000 |
| PMID | 11123912 |
| DOI | 10.1021/bi001474d |