PPIST01092
Protein Information
| Protein_Chain | B |
|---|---|
| Protein_Sequence | SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA |
Peptide Information
| Peptide_Chain | A |
|---|---|
| Peptide_Sequence | RMNIQMLLEAADYLER |
| Peptide_Length | 16 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1G1E |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the interacting domains of the Mad-Sin3 complex: implications for recruitment of a chromatin-modifying complex. |
|---|---|
| Release_Year | 2000 |
| PMID | 11106735 |
| DOI | 10.1016/S0092-8674(00)00168-9 |