PPIST01117
Protein Information
| Protein_Chain | B[auth L]/A[auth H] |
|---|---|
| Protein_Sequence | DIVLTQSPASLAVSLGQRATISCKASQSVDYDGDSYMNWYQQKPGQPPKLLIYAASNLESGIPARFSGSGSRTDFTLNIHPVEEEDAATYYCQQSNEDPFTFGSGTKLEIKR/QVQLQQSGAELVKPGASVKMSCKASGYTFTTYPIEWMKQNHGKSLEWIGNFHPYSDDTNYNEKFKGKAKLTVEKSSSTVYLEFSRLTSDDSAVYYCAIHYGSAYAMDYWGQGTSVTVSS |
Peptide Information
| Peptide_Chain | C[auth P] |
|---|---|
| Peptide_Sequence | RKSIRIQRGPGRAFVTIG |
| Peptide_Length | 18 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1QNZ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR Structure of an Anti-Gp120 Antibody Complex with a V3 Peptide Reveals a Surface Important for Co-Receptor Binding |
|---|---|
| Release_Year | 2000 |
| PMID | 10801487 |
| DOI | 10.1016/S0969-2126(00)00119-2 |