PPIST01207
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | WRYYESSLEPYPD |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1HAJ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | A Beta-Hairpin Structure in a 13-mer Peptide that Binds Alpha-Bungarotoxin with High Affinity and Neutralizes its Toxicity |
|---|---|
| Release_Year | 2001 |
| PMID | 11381118 |
| DOI | 10.1073/PNAS.111164298 |