PPIST01240
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | YRGWKHWVYYTCCPDTPYS |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1IDG |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica. |
|---|---|
| Release_Year | 2001 |
| PMID | 11312275 |
| DOI | 10.1074/jbc.M102300200 |