PPIST01304
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GNGRFLTLKPLPDSIIQESLEIQQGVNPFFIGRSEDCNCKIEDNRLSRVHCFIFKKRHAVGKSMYESPAQGLDDIWYCHTGTNVSYLNNNRMIQGTKFLLQDGDEIKIIWDKNNKFVIGFKVEINDTTGLFNEGLGMLQEQRVVLKQTAEEKDLVKKL |
Peptide Information
| Peptide_Chain | B[auth P] |
|---|---|
| Peptide_Sequence | EDIYYLD |
| Peptide_Length | 7 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1K2M |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the yeast Rad53 FHA2 complexed with a phosphothreonine peptide pTXXL: comparison with the structures of FHA2-pYXL and FHA1-pTXXD complexes. |
|---|---|
| Release_Year | 2001 |
| PMID | 11846568 |
| DOI | 10.1006/jmbi.2001.5141 |