PPIST01309
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | ATQRFLIEKFSQEQIGENIVCRVICTTGQIPIRDLSADISQVLKEKRSIKKVWTFGRNPACDYHLGNISRLSNKHFQILLGEDGNLLLNDISTNGTWLNGQKVEKNSNQLLSQGDEITVGVGVESDILSLVIFINDKFKQCLEQNKVDRIR |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | SLEVTEADATFVQ |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1K3Q |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structures of two FHA1-phosphothreonine peptide complexes provide insight into the structural basis of the ligand specificity of FHA1 from yeast Rad53. |
|---|---|
| Release_Year | 2001 |
| PMID | 11846567 |
| DOI | 10.1006/jmbi.2001.5140 |