PPIST01316
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | FEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRK |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XPLPPY |
| Peptide_Length | 6 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 1K9R |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structures of the YAP65 WW domain and the variant L30 K in complex with the peptides GTPPPPYTVG, N-(n-octyl)-GPPPY and PLPPY and the application of peptide libraries reveal a minimal binding epitope. |
|---|---|
| Release_Year | 2001 |
| PMID | 11743730 |
| DOI | 10.1006/jmbi.2000.5199 |