PPIST01330
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | PKPGDIFEVELAKNDNSLGISVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRNTGQVVHLLLEKGQSPT |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | FADSEADENEQVSAV |
| Peptide_Length | 15 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1D5G |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution Structure of the PDZ2 Domain from Cytosolic Human Phosphatase hPTP1E Complexed with a Peptide Reveals Contribution of the beta2-beta3 Loop to PDZ Domain-Ligand Interactions |
|---|---|
| Release_Year | 2002 |
| PMID | 12095257 |
| DOI | 10.1016/S0022-2836(02)00544-2 |