PPIST01393
Protein Information
| Protein_Chain | C/A |
|---|---|
| Protein_Sequence | DPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSK/SWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHYIINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | EPGPYAQPSVNTK |
| Peptide_Length | 13 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1JU5 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide |
|---|---|
| Release_Year | 2002 |
| PMID | 12384576 |
| DOI | 10.1073/pnas.212518799 |