PPIST01406
Protein Information
| Protein_Chain | A[auth V];B[auth W] |
|---|---|
| Protein_Sequence | HHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKD |
Peptide Information
| Peptide_Chain | C[auth X];D[auth Y] |
|---|---|
| Peptide_Sequence | GGNECDIARMWEWECFERL |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1KAT |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution Structure of a Phage-derived Peptide Antagonist in Complex with Vascular Endothelial Growth Factor |
|---|---|
| Release_Year | 2002 |
| PMID | 11866530 |
| DOI | 10.1006/jmbi.2001.5370 |