PPIST01484
Protein Information
| Protein_Chain | A[auth C] |
|---|---|
| Protein_Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDS |
Peptide Information
| Peptide_Chain | B[auth I] |
|---|---|
| Peptide_Sequence | RISADAMMQALLGARAK |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1LXF |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structure of the regulatory N-domain of human cardiac troponin C in complex with human cardiac troponin I147-163 and bepridil. |
|---|---|
| Release_Year | 2002 |
| PMID | 12060657 |
| DOI | 10.1074/jbc.M203896200 |