PPIST01485
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | YRGWKHWVYYTCCPDTPYS |
| Peptide_Length | 19 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1LXG |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR-based Binding Screen and Structural Analysis of the Complex Formed between alpha-Cobratoxin and an 18-mer Cognate Peptide Derived from the alpha1 Subunit of the Nicotinic Acetylcholine Receptor from Torpedo californica |
|---|---|
| Release_Year | 2002 |
| PMID | 12133834 |
| DOI | 10.1074/jbc.M205483200 |