PPIST01487
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLRSDQMTLQDAKVLLEAALRQESGARGSHHHHHH |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | XDEYDDPFX |
| Peptide_Length | 9 |
| Non-standard residues | Yes |
Interaction Information
| PDB_ID | 1M0V |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure and phosphopeptide binding to the N-terminal domain of Yersinia YopH: comparison with a crystal structure |
|---|---|
| Release_Year | 2002 |
| PMID | 12234185 |
| DOI | 10.1021/bi026333l |