PPIST01561
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | APSIDRSTKPA |
| Peptide_Length | 11 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1H3H |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Structural Basis for Specific Binding of the Gads SH3 Domain to an Rxxk Motif-Containing Slp-76 Peptide: A Novel Mode of Peptide Recognition |
|---|---|
| Release_Year | 2003 |
| PMID | 12620234 |
| DOI | 10.1016/S1097-2765(03)00046-7 |