PPIST01625
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GSPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | PQPEYVNQPD |
| Peptide_Length | 10 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1MW4 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Solution structure of the human Grb7-SH2 domain/erbB2 peptide complex and structural basis for Grb7 binding to ErbB2 |
|---|---|
| Release_Year | 2003 |
| PMID | 12975581 |
| DOI | 10.1023/A:1025498409113 |