PPIST01655
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKCELDAIICEVDEDGSGTIDFEEFLVMMVRQMKEDA |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | RMSADAMLRALLGSKHK |
| Peptide_Length | 17 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1NPQ |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | NMR Structure of a Bifunctional Rhodamine Labeled N-Domain of Troponin C Complexed with the Regulatory Switch Peptide from Troponin I: Implications for in Situ Fluorescence Studies in Muscle Fibers |
|---|---|
| Release_Year | 2003 |
| PMID | 12693929 |
| DOI | 10.1021/bi027041n |