PPIST01705
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDSLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | SVDYVPML |
| Peptide_Length | 8 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1OO4 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Nuclear magnetic resonance structure of the P395S mutant of the N-SH2 domain of the p85 subunit of PI3 kinase: an SH2 domain with altered specificity |
|---|---|
| Release_Year | 2003 |
| PMID | 14503862 |
| DOI | 10.1021/bi034353x |