PPIST01791
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | MGSSHHHHHHGLVPRGSHMVDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGL |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | NRLLLTG |
| Peptide_Length | 7 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1Q5L |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | The solution structure of the bacterial HSP70 chaperone protein domain DnaK(393-507) in complex with the peptide NRLLLTG. |
|---|---|
| Release_Year | 2003 |
| PMID | 14573869 |
| DOI | 10.1110/ps.03269103 |