PPIST01909
Protein Information
| Protein_Chain | A |
|---|---|
| Protein_Sequence | EYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPHHHHHH |
Peptide Information
| Peptide_Chain | B |
|---|---|
| Peptide_Sequence | YKKTEV |
| Peptide_Length | 6 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1RGR |
|---|---|
| Method | SOLUTION NMR |
| Resolution | |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | Targeting Specific PDZ Domains of PSD-95; Structural Basis for Enhanced Affinity and Enzymatic Stability of a Cyclic Peptide. |
|---|---|
| Release_Year | 2004 |
| PMID | 15123241 |
| DOI | 10.1016/j.chembiol.2004.03.013 |