PPIST02175
Protein Information
| Protein_Chain | B |
|---|---|
| Protein_Sequence | GRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKKLEKCRGVFPENFTERVP |
Peptide Information
| Peptide_Chain | A |
|---|---|
| Peptide_Sequence | LLPTPPLSPSRRSG |
| Peptide_Length | 14 |
| Non-standard residues | No |
Interaction Information
| PDB_ID | 1MV0 |
|---|---|
| Method | SOLUTION NMR |
| Resolution | None |
| Structure | |
| Protein-peptide residue interaction | |
| Interaction_xlsx | Download interaction table (.xlsx) |
Reference Information
| Title | A structure-based model of the c-Myc/Bin1 protein interaction shows alternative splicing of Bin1 and c-Myc phosphorylation are key binding determinants. |
|---|---|
| Release_Year | 2005 |
| PMID | 15992821 |
| DOI | 10.1016/j.jmb.2005.05.046 |